Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG5 Peptide - N-terminal region

BAG5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BAG-5

UniProt

Q9UL15

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAG5 Rabbit Polyclonal Antibody (orb331161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015049

Preservative

Lyophilized powder

AA Sequence

LSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL
BNC740978-100 1x 100 µL

CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-100 1x 100 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details