Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG6 Peptide - C-terminal region

BAG6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAG-6, BAG6, D6S52E, G3, BAT3

UniProt

P46379

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAG6 Rabbit Polyclonal Antibody (orb585077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004630

Preservative

Lyophilized powder

AA Sequence

ARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfo rhodamine amidoethyl mercaptan
sc-460280 5 mg

Sulfo rhodamine amidoethyl mercaptan

Sign In for Pricing
View Details
NOTCH4 Polyclonal Antibody
MBS2563188-01 0.02 mL

NOTCH4 Polyclonal Antibody

Sign In for Pricing
View Details
NOTCH4 Polyclonal Antibody
MBS2563188-02 0.06 mL

NOTCH4 Polyclonal Antibody

Sign In for Pricing
View Details
NOTCH4 Polyclonal Antibody
MBS2563188-03 0.12 mL

NOTCH4 Polyclonal Antibody

Sign In for Pricing
View Details
NOTCH4 Polyclonal Antibody
MBS2563188-04 0.2 mL

NOTCH4 Polyclonal Antibody

Sign In for Pricing
View Details
NOTCH4 Polyclonal Antibody
MBS2563188-05 5x 0.2 mL

NOTCH4 Polyclonal Antibody

Sign In for Pricing
View Details