Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Banf2 Peptide - N-terminal region

Banf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4930517K23Rik, Baf-L, Baf-like, Gm115, RP23-17O9.1

UniProt

Q8BVR0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Banf2 Rabbit Polyclonal Antibody (orb326265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997158

Preservative

Lyophilized powder

AA Sequence

DDMSPRLRAFLSEPIGEKDVAWVDGISRELAINLVTKGFNKAYVLLGQFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CtIP Lentiviral Activation Particles (h2)
sc-401292-LAC-2 200 µL

CtIP Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
EIF2D Knockout NCI-H1975 Polyclonal Cells
ARG41002 1 Million

EIF2D Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
Bex4 Lentiviral Activation Particles (m2)
sc-436560-LAC-2 200 µL

Bex4 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Bzw1 siRNA Oligos set (Rat)
13593176 3x 5 nmol

Bzw1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
2-Ethoxy-5- (tributylstannyl) -1,3-thiazole
sc-356417 1 g

2-Ethoxy-5- (tributylstannyl) -1,3-thiazole

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans nhr-268 Polyclonal Antibody
MBS7179839 Inquire

Rabbit anti-Caenorhabditis elegans nhr-268 Polyclonal Antibody

Sign In for Pricing
View Details