Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Banf2 Peptide - N-terminal region

Banf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4930517K23Rik, Baf-L, Baf-like, Gm115, RP23-17O9.1

UniProt

Q8BVR0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Banf2 Rabbit Polyclonal Antibody (orb326265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997158

Preservative

Lyophilized powder

AA Sequence

DDMSPRLRAFLSEPIGEKDVAWVDGISRELAINLVTKGFNKAYVLLGQFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H1FNT Protein Lysate (Human) with C-Ha Tag
22905031 100 µg

H1FNT Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
YPEL1 Rabbit Polyclonal Antibody
E28PN8171 100 µL

YPEL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD68 Mouse Monoclonal Antibody [Clone ID: LBI6D3]
AMM15753VCF 100 µg

CD68 Mouse Monoclonal Antibody [Clone ID: LBI6D3]

Sign In for Pricing
View Details
Recombinant Mycoplasma hyopneumoniae Heat-inducible transcription repressor HrcA (hrcA)
MBS1309651-01 0.02 mg (E-Coli)

Recombinant Mycoplasma hyopneumoniae Heat-inducible transcription repressor HrcA (hrcA)

Sign In for Pricing
View Details
Recombinant Mycoplasma hyopneumoniae Heat-inducible transcription repressor HrcA (hrcA)
MBS1309651-02 0.02 mg (Yeast)

Recombinant Mycoplasma hyopneumoniae Heat-inducible transcription repressor HrcA (hrcA)

Sign In for Pricing
View Details
Recombinant Mycoplasma hyopneumoniae Heat-inducible transcription repressor HrcA (hrcA)
MBS1309651-03 0.1 mg (E-Coli)

Recombinant Mycoplasma hyopneumoniae Heat-inducible transcription repressor HrcA (hrcA)

Sign In for Pricing
View Details