Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Barx2 Peptide - N-terminal region

Barx2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310006E12Rik, Barx2b

UniProt

O08686

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Barx2 Rabbit Polyclonal Antibody (orb576237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038828

Preservative

Lyophilized powder

AA Sequence

LSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK1+JNK3 Recombinant Rabbit Monoclonal Antibody [JJ08-86]
ET1701-47 100 µL

JNK1+JNK3 Recombinant Rabbit Monoclonal Antibody [JJ08-86]

Sign In for Pricing
View Details
Human PGRN (Progranulin) ELISA Kit
E-EL-H1578-01 24 Tests

Human PGRN (Progranulin) ELISA Kit

Sign In for Pricing
View Details
Human PGRN (Progranulin) ELISA Kit
E-EL-H1578-02 48 Tests

Human PGRN (Progranulin) ELISA Kit

Sign In for Pricing
View Details
Human PGRN (Progranulin) ELISA Kit
E-EL-H1578-03 96 Tests

Human PGRN (Progranulin) ELISA Kit

Sign In for Pricing
View Details
Ly6c1 (NM_010741) Mouse Tagged ORF Clone
MG200746 10 µg

Ly6c1 (NM_010741) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
JUND pSer255 Rabbit Polyclonal Antibody
AP01624PU-N 100 µg

JUND pSer255 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details