Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Barx2 Peptide - N-terminal region

Barx2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310006E12Rik, Barx2b

UniProt

O08686

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Barx2 Rabbit Polyclonal Antibody (orb576237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038828

Preservative

Lyophilized powder

AA Sequence

LSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS502141 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS503126 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Wdr55 Mouse Gene Knockout Kit (CRISPR)
KN519370 1 Kit

Wdr55 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(2E)-Decenal
TRC-C475100-50G 50 g

(2E)-Decenal

Sign In for Pricing
View Details
FAM47A Human Gene Knockout Kit (CRISPR)
KN415763 1 Kit

FAM47A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF740 conjugate, 0.1mg/mL
BNC743175-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details