Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BASP1 Peptide - N-terminal region

BASP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAP-23, CAP23, MGC8555, NAP-22, NAP22

UniProt

P80723

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BASP1 Rabbit Polyclonal Antibody (orb584514) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006308

Preservative

Lyophilized powder

AA Sequence

SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS705017 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Acvr1 Mouse Gene Knockout Kit (CRISPR)
KN500800 1 Kit

Acvr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTP rho (PTPRT) Human Gene Knockout Kit (CRISPR)
KN213847BN 1 Kit

PTP rho (PTPRT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCF2 (NM_001171878) Human Over-expression Lysate
LY433549 100 µg

MCF2 (NM_001171878) Human Over-expression Lysate

Sign In for Pricing
View Details
SAMD12 Human Gene Knockout Kit (CRISPR)
KN419835 1 Kit

SAMD12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD299 (CLEC4M) (NM_014257) Human Over-expression Lysate
LY402300 100 µg

CD299 (CLEC4M) (NM_014257) Human Over-expression Lysate

Sign In for Pricing
View Details