Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BASP1 Peptide - N-terminal region

BASP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAP-23, CAP23, MGC8555, NAP-22, NAP22

UniProt

P80723

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BASP1 Rabbit Polyclonal Antibody (orb584514) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006308

Preservative

Lyophilized powder

AA Sequence

SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPDPFL (NM_001007176) Human Over-expression Lysate
LC422807 20 µg

PPDPFL (NM_001007176) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), 1mg/mL
BNUM1388-50 1x 50 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), 1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Cecum
CR562461 5 µg

Tissue Total RNA, Cecum

Sign In for Pricing
View Details
TJP1 antibody
FNab09750 100 µg

TJP1 antibody

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 1mg/mL
BNUM1948-50 1x 50 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 1mg/mL

Sign In for Pricing
View Details
CD137 (TNFRSF9) Mouse Monoclonal Antibody [Clone ID: OTI4G1]
CF813073 100 µg

CD137 (TNFRSF9) Mouse Monoclonal Antibody [Clone ID: OTI4G1]

Sign In for Pricing
View Details