Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bbs1 Peptide - N-terminal region

Bbs1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI451249, D19Ertd609e

UniProt

Q3V3N7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bbs1 Rabbit Polyclonal Antibody (orb583655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028300

Preservative

Lyophilized powder

AA Sequence

PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHST11 (NM_001173982) Human Over-expression Lysate
LY432922 100 µg

CHST11 (NM_001173982) Human Over-expression Lysate

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), Biotin conjugate, 0.1mg/mL
BNCB1372-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS710194 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
IDH1 (IDH1/1152), CF568 conjugate, 0.1mg/mL
BNC681152-100 1x 100 µL

IDH1 (IDH1/1152), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1C Antibody
OC-577-01 50 μL

CD1C Antibody

Sign In for Pricing
View Details
CD1C Antibody
OC-577-02 100 µL

CD1C Antibody

Sign In for Pricing
View Details