Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bbs1 Peptide - N-terminal region

Bbs1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI451249, D19Ertd609e

UniProt

Q3V3N7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bbs1 Rabbit Polyclonal Antibody (orb583655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028300

Preservative

Lyophilized powder

AA Sequence

PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMX2 (C-term) Rabbit Polyclonal Antibody
AP13980PU-N 400 µL

HMX2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IMPA1 Polyclonal Antibody
E-AB-18668-01 20 µL

IMPA1 Polyclonal Antibody

Sign In for Pricing
View Details
IMPA1 Polyclonal Antibody
E-AB-18668-02 60 µL

IMPA1 Polyclonal Antibody

Sign In for Pricing
View Details
IMPA1 Polyclonal Antibody
E-AB-18668-03 120 µL

IMPA1 Polyclonal Antibody

Sign In for Pricing
View Details
IMPA1 Polyclonal Antibody
E-AB-18668-04 200 µL

IMPA1 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS503919 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details