Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS10 Peptide - C-terminal region

BBS10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C12orf58, FLJ23560

UniProt

Q8TAM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBS10 Rabbit Polyclonal Antibody (orb584464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078961

Preservative

Lyophilized powder

AA Sequence

SQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Acetamidonaphthalene
TRC-A158455-2G 2 g

1-Acetamidonaphthalene

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF640R conjugate, 0.1mg/mL
BNC400780-500 1x 500 µL

HSP60 (HSPD1/780), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RFX3 (NM_134428) Human Over-expression Lysate
LY403344 100 µg

RFX3 (NM_134428) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM249 (NM_001252404) Human Tagged ORF Clone
RG236653 10 µg

TMEM249 (NM_001252404) Human Tagged ORF Clone

Sign In for Pricing
View Details
C6orf140 (GLYATL3) (NM_001010904) Human Over-expression Lysate
LY425285 100 µg

C6orf140 (GLYATL3) (NM_001010904) Human Over-expression Lysate

Sign In for Pricing
View Details
CBR3 Human Gene Knockout Kit (CRISPR)
KN401073 1 Kit

CBR3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details