BBS10 Peptide - C-terminal region
BBS10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C12orf58, FLJ23560
UniProt
Q8TAM1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BBS10 Rabbit Polyclonal Antibody (orb584464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078961
Preservative
Lyophilized powder
AA Sequence
SQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC-16257-01 50 μL
Recombinant Extracellular Matrix Protein 1 Antibody
Sign In for Pricing
View Details RC-16257-02 100 µL
Recombinant Extracellular Matrix Protein 1 Antibody
Sign In for Pricing
View Details RC-16257-03 1 mL
Recombinant Extracellular Matrix Protein 1 Antibody
Sign In for Pricing
View Details 
LY428761 100 µg
Transcription Factor SP9 (SP9) (NM_001145250) Human Over-expression Lysate
Sign In for Pricing
View Details 
