Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS2 Peptide - middle region

BBS2 Peptide - middle region

Product Specifications

Product Name Alternative

BBS, MGC20703

UniProt

Q9BXC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBS2 Rabbit Polyclonal Antibody (orb584438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114091

Preservative

Lyophilized powder

AA Sequence

RGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mef2b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7605807 1.0 µg DNA

Mef2b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
orb334796-01 30 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
orb334796-02 50 μL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
orb334796-03 100 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
orb334796-04 200 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GJA10 Protein Lysate (Rat) with C-HA Tag
21533036 100 µg

GJA10 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details