BBS2 Peptide - middle region
BBS2 Peptide - middle region
Product Specifications
Product Name Alternative
BBS, MGC20703
UniProt
Q9BXC9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BBS2 Rabbit Polyclonal Antibody (orb584438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_114091
Preservative
Lyophilized powder
AA Sequence
RGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELA
More Discoveries
Explore Other Products
Browse additional items from our catalog
ELK2855-01 48 Tests
Human ECM1 (Extracellular Matrix Protein 1) ELISA Kit
Sign In for Pricing
View Details 
ELK2855-02 96 Tests
Human ECM1 (Extracellular Matrix Protein 1) ELISA Kit
Sign In for Pricing
View Details ELK2855-03 5x 96 Tests
Human ECM1 (Extracellular Matrix Protein 1) ELISA Kit
Sign In for Pricing
View Details 