Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS2 Peptide - N-terminal region

BBS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BBS, MGC20703

UniProt

Q9BXC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBS2 Rabbit Polyclonal Antibody (orb584439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114091

Preservative

Lyophilized powder

AA Sequence

GSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cystatin A Antibody
NBP2-99328-50ul 50 µL

Rabbit Polyclonal Cystatin A Antibody

Sign In for Pricing
View Details
0610038F07Rik (BC060090) Mouse Tagged Lenti ORF Clone
MR200796L4 10 µg

0610038F07Rik (BC060090) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Synaptophysin Antibody
MBS8510751-01 0.05 mg

Synaptophysin Antibody

Sign In for Pricing
View Details
Synaptophysin Antibody
MBS8510751-02 0.1 mg

Synaptophysin Antibody

Sign In for Pricing
View Details
Synaptophysin Antibody
MBS8510751-03 0.1 mL (AF750)

Synaptophysin Antibody

Sign In for Pricing
View Details
Synaptophysin Antibody
MBS8510751-04 0.1 mL (AF405M)

Synaptophysin Antibody

Sign In for Pricing
View Details