Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS2 Peptide - N-terminal region

BBS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BBS, MGC20703

UniProt

Q9BXC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBS2 Rabbit Polyclonal Antibody (orb584439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114091

Preservative

Lyophilized powder

AA Sequence

GSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD32A Protein, Cynomolgus, Recombinant (His Tag)
E45K54076M2-100 100 µg

CD32A Protein, Cynomolgus, Recombinant (His Tag)

Sign In for Pricing
View Details
NRSN2 Polyclonal Antibody
RA33640-01 50 µL

NRSN2 Polyclonal Antibody

Sign In for Pricing
View Details
NRSN2 Polyclonal Antibody
RA33640-02 100 µL

NRSN2 Polyclonal Antibody

Sign In for Pricing
View Details
OVA Conjugated Neuropeptide S (NPS)
SDPA463Mu21-01 10 µg

OVA Conjugated Neuropeptide S (NPS)

Sign In for Pricing
View Details
OVA Conjugated Neuropeptide S (NPS)
SDPA463Mu21-02 50 µg

OVA Conjugated Neuropeptide S (NPS)

Sign In for Pricing
View Details
OVA Conjugated Neuropeptide S (NPS)
SDPA463Mu21-03 200 µg

OVA Conjugated Neuropeptide S (NPS)

Sign In for Pricing
View Details