Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS5 Peptide - N-terminal region

BBS5 Peptide - N-terminal region

Product Specifications

UniProt

Q8N3I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBS5 Rabbit Polyclonal Antibody (orb581883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689597

Preservative

Lyophilized powder

AA Sequence

MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALR1 Antibody
8G267-AAT 50 µg

GALR1 Antibody

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), Biotin conjugate, 0.1mg/mL
BNCB1887-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM200A (NM_052913) Human Over-expression Lysate
LY403269 100 µg

TMEM200A (NM_052913) Human Over-expression Lysate

Sign In for Pricing
View Details
6X His tag Recombinant Rabbit monoclonal Antibody
HA720222F 100 µL

6X His tag Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PWP1 Human Knockdown Lysate
LY300411 100 µg

PWP1 Human Knockdown Lysate

Sign In for Pricing
View Details
IL6 Mouse Monoclonal Antibody [Clone ID: 1B6]
AM26386PU-L 500 µg

IL6 Mouse Monoclonal Antibody [Clone ID: 1B6]

Sign In for Pricing
View Details