Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS5 Peptide - N-terminal region

BBS5 Peptide - N-terminal region

Product Specifications

UniProt

Q8N3I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBS5 Rabbit Polyclonal Antibody (orb581883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689597

Preservative

Lyophilized powder

AA Sequence

MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENaC beta Antibody: Biotin
SMC-241D-BI 100 µg

ENaC beta Antibody: Biotin

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (CPTC-HSPD1-1), CF488A conjugate, 0.1mg/mL
BNC882245-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (CPTC-HSPD1-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR563039 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
GTF2A1L Antibody
KC-35074-01 50 μL

GTF2A1L Antibody

Sign In for Pricing
View Details
GTF2A1L Antibody
KC-35074-02 100 µL

GTF2A1L Antibody

Sign In for Pricing
View Details
GTF2A1L Antibody
KC-35074-03 1 mL

GTF2A1L Antibody

Sign In for Pricing
View Details