BCAM Peptide - C-terminal region
BCAM Peptide - C-terminal region
Product Specifications
Product Name Alternative
AU, CD239, LU, MSK19
UniProt
P50895
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BCAM Rabbit Polyclonal Antibody (orb584616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005572
Preservative
Lyophilized powder
AA Sequence
SALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2180-100 1x 100 µL
EGFR (Epidermal Growth Factor Receptor) (F4), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH032094-01 10 µg
Recombinant Human Astrocytic Phosphoprotein PEA-15/PEA15 Protein
Sign In for Pricing
View Details PKSH032094-02 50 µg
Recombinant Human Astrocytic Phosphoprotein PEA-15/PEA15 Protein
Sign In for Pricing
View Details 
BNC400525-100 1x 100 µL
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details