Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAM Peptide - C-terminal region

BCAM Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU, CD239, LU, MSK19

UniProt

P50895

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCAM Rabbit Polyclonal Antibody (orb584617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005572

Preservative

Lyophilized powder

AA Sequence

ADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse ANGPTL3 Protein (Fc Tag)
PDMM100045-01 20 µg

Recombinant Mouse ANGPTL3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse ANGPTL3 Protein (Fc Tag)
PDMM100045-02 100 µg

Recombinant Mouse ANGPTL3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse ANGPTL3 Protein (Fc Tag)
PDMM100045-03 500 µg

Recombinant Mouse ANGPTL3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse ANGPTL3 Protein (Fc Tag)
PDMM100045-04 1 mg

Recombinant Mouse ANGPTL3 Protein (Fc Tag)

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1491), Biotin conjugate, 0.1mg/mL
BNCB1491-500 1x 500 µL

PAX8 (Renal Cell Marker) (PAX8/1491), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2784), CF647 conjugate, 0.1mg/mL
BNC472784-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2784), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details