Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcat1 Peptide - C-terminal region

Bcat1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BCATc, Eca39

UniProt

Q8CBC8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bcat1 Rabbit Polyclonal Antibody (orb579691) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001019639

Preservative

Lyophilized powder

AA Sequence

ACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)
MBS1182391-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)
MBS1182391-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)
MBS1182391-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)
MBS1182391-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)
MBS1182391-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)
MBS1182391-06 1 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 147 (LCR1)

Sign In for Pricing
View Details