Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcat1 Peptide - C-terminal region

Bcat1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BCATc, Eca39

UniProt

Q8CBC8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bcat1 Rabbit Polyclonal Antibody (orb579691) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001019639

Preservative

Lyophilized powder

AA Sequence

ACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP2A1 (NM_173201) Human Tagged ORF Clone
RC214911 10 µg

ATP2A1 (NM_173201) Human Tagged ORF Clone

Sign In for Pricing
View Details
Immunoglobulin Binding Protein 1 (IGBP1) Antibody
abx125981-01 20 µL

Immunoglobulin Binding Protein 1 (IGBP1) Antibody

Sign In for Pricing
View Details
Immunoglobulin Binding Protein 1 (IGBP1) Antibody
abx125981-02 100 µL

Immunoglobulin Binding Protein 1 (IGBP1) Antibody

Sign In for Pricing
View Details
Immunoglobulin Binding Protein 1 (IGBP1) Antibody
abx125981-03 2x 100 µL

Immunoglobulin Binding Protein 1 (IGBP1) Antibody

Sign In for Pricing
View Details
Embelin
E-310-10-10mg 10 mg

Embelin

Sign In for Pricing
View Details
TXNRD1 Recombinant Protein
OPCD07731-200UG 200 µg

TXNRD1 Recombinant Protein

Sign In for Pricing
View Details