Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAT2 Peptide - N-terminal region

BCAT2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BCAM, BCT2, PP18, BCATM

UniProt

O15382

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCAT2 Rabbit Polyclonal Antibody (orb585276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001181

Preservative

Lyophilized powder

AA Sequence

GPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353E-01 50 Tests

APC Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
APC Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353E-02 100 Tests

APC Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
APC Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353E-03 2x 100 Tests

APC Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
ZNF480 Mouse Monoclonal Antibody [Clone ID: OTI4G2]
CF812641 100 µg

ZNF480 Mouse Monoclonal Antibody [Clone ID: OTI4G2]

Sign In for Pricing
View Details
IFNA1 Antibody
KC-519-01 50 μL

IFNA1 Antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-519-02 100 µL

IFNA1 Antibody

Sign In for Pricing
View Details