Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAT2 Peptide - N-terminal region

BCAT2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BCAM, BCT2, PP18, BCATM

UniProt

O15382

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCAT2 Rabbit Polyclonal Antibody (orb585276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001181

Preservative

Lyophilized powder

AA Sequence

GPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), Biotin conjugate, 0.1mg/mL
BNCB1631-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pf4 (NM_019932) Mouse Tagged ORF Clone
MG200359 10 µg

Pf4 (NM_019932) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712681 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PE Anti-Human CD45 Antibody[HI30]
E-AB-F1137D-01 20 Tests

PE Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
PE Anti-Human CD45 Antibody[HI30]
E-AB-F1137D-02 100 Tests

PE Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
PE Anti-Human CD45 Antibody[HI30]
E-AB-F1137D-03 2x 100 Tests

PE Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details