Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL11A Peptide - C-terminal region

BCL11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

BCL11A-L, BCL11A-S, BCL11A-XL, CTIP1, EVI9, FLJ10173, FLJ34997, HBFQTL5, KIAA1809, ZNF856

UniProt

Q9H165

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCL11A Rabbit Polyclonal Antibody (orb577178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075044

Preservative

Lyophilized powder

AA Sequence

YACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caps2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3893405 3x 1.0 µg

Caps2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Apolipoprotein A-I (Apo A1) AssayLite™ Antibody (APC Conjugate)
11151-05061 5x 30 µg

Human Apolipoprotein A-I (Apo A1) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
Rabbit Monoclonal CBX1 Antibody (RAB-C145) [Alexa Fluor 488] - Chimeric
NBP3-20129AF488 0.1 mL

Rabbit Monoclonal CBX1 Antibody (RAB-C145) [Alexa Fluor 488] - Chimeric

Sign In for Pricing
View Details
UBD Rabbit Polyclonal Antibody (HRP)
orb2117135 100 µL

UBD Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
SLC5A2
576967-01 50 µg

SLC5A2

Sign In for Pricing
View Details
SLC5A2
576967-02 100 µg

SLC5A2

Sign In for Pricing
View Details