Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL11A Peptide - C-terminal region

BCL11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

BCL11A-L, BCL11A-S, BCL11A-XL, CTIP1, EVI9, FLJ10173, FLJ34997, HBFQTL5, KIAA1809, ZNF856

UniProt

Q9H165

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCL11A Rabbit Polyclonal Antibody (orb577178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075044

Preservative

Lyophilized powder

AA Sequence

YACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NBPF15 (NM_001170755) AAV Particle
RC230414A1V 250 µL

Human NBPF15 (NM_001170755) AAV Particle

Sign In for Pricing
View Details
SPERT shRNA Plasmid (h)
sc-76558-SH 20 µg

SPERT shRNA Plasmid (h)

Sign In for Pricing
View Details
C4orf48 Protein Vector (Human) (pPM-N-D-C-HA)
PV331208 500 ng

C4orf48 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Tucidinostat (Chidamide) 5mg
A17861-5 5 mg

Tucidinostat (Chidamide) 5mg

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium E3 ubiquitin-protein ligase SopA (sopA), partial
MBS1289980 Inquire

Recombinant Salmonella typhimurium E3 ubiquitin-protein ligase SopA (sopA), partial

Sign In for Pricing
View Details
Mas1 (NM_012757) Rat Tagged ORF Clone Lentiviral Particle
RR203625L3V 200 µL

Mas1 (NM_012757) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details