What is the catalog number for BCL11B Peptide - C-terminal region?

The catalog number for BCL11B Peptide - C-terminal region is orb2011576.

What sizes are available for BCL11B Peptide - C-terminal region?

BCL11B Peptide - C-terminal region is available in the following size(s): 100 µg.

Is BCL11B Peptide - C-terminal region in stock?

BCL11B Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

BCL11B Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTIP-2, CTIP2, RIT1, hRIT1-alpha, ZNF856B

UniProt

Q9C0K0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_612808

Preservative

Lyophilized powder

AA Sequence

RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

49854021 500 ng

VN1R104P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing

View Details

K0580803 1.0 µg DNA

DEFB119 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing

View Details

MBS1120222 Inquire

Recombinant Human Protein FAM115C (FAM115C) , partial

Sign In for Pricing

View Details

126496-APC 100 µL

EWSR1 (Ewing Sarcoma Breakpoint Region 1 Protein, EWS Oncogene, RNA-binding Protein EWS, EWS, bK984G1.4, CAGF29) (APC)

Sign In for Pricing

View Details

GTR15162839 1 Vial

Lentiviral human FBXL8 shRNA (UAS) - Lentiviral human FBXL8 shRNA (UAS, RFP) (25)

Sign In for Pricing

View Details

orb402407 100 µg

LBP Rabbit Polyclonal Antibody

Sign In for Pricing

View Details