Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL11B Peptide - C-terminal region

BCL11B Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTIP-2, CTIP2, RIT1, hRIT1-alpha, ZNF856B

UniProt

Q9C0K0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_612808

Preservative

Lyophilized powder

AA Sequence

RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Plk3 Antibody - N-terminal region
OAAB11025-400UL 400 µL

Mouse Plk3 Antibody - N-terminal region

Sign In for Pricing
View Details
BIBF 1202
BUP10984-01 5 mg

BIBF 1202

Sign In for Pricing
View Details
BIBF 1202
BUP10984-02 25 mg

BIBF 1202

Sign In for Pricing
View Details
BIBF 1202
BUP10984-03 50 mg

BIBF 1202

Sign In for Pricing
View Details
BIBF 1202
BUP10984-04 100 mg

BIBF 1202

Sign In for Pricing
View Details
BIBF 1202
BUP10984-05 200 mg

BIBF 1202

Sign In for Pricing
View Details