Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2 Peptide - middle region

BCL2 Peptide - middle region

Product Specifications

Product Name Alternative

Bcl-2, PPP1R50

UniProt

P10415

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCL2 Rabbit Polyclonal Antibody (orb584143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000624

Preservative

Lyophilized powder

AA Sequence

ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akap6 sgRNA CRISPR Lentivector set (Rat)
K7108001 3x 1.0 µg

Akap6 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
EIF4A1 (NM_001204510) Human Untagged Clone
SC329761 10 µg

EIF4A1 (NM_001204510) Human Untagged Clone

Sign In for Pricing
View Details
Human CD5L ELISA Kit
orb405685-01 24 Tests

Human CD5L ELISA Kit

Sign In for Pricing
View Details
Human CD5L ELISA Kit
orb405685-02 48 Tests

Human CD5L ELISA Kit

Sign In for Pricing
View Details
Human CD5L ELISA Kit
orb405685-03 96 Tests

Human CD5L ELISA Kit

Sign In for Pricing
View Details
Human CD5L ELISA Kit
orb405685-04 5 x 96 T

Human CD5L ELISA Kit

Sign In for Pricing
View Details