BCL2 Peptide - middle region
BCL2 Peptide - middle region
Product Specifications
Product Name Alternative
Bcl-2, PPP1R50
UniProt
P10415
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BCL2 Rabbit Polyclonal Antibody (orb584143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000624
Preservative
Lyophilized powder
AA Sequence
ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2252-01A 100 µg
CD1a (CD1A Antigen, CD1, Cortical Thymocyte Antigen CD1A, Epidermal Dendritic Cell Marker CD1a, FCB6, HTA1, hTa1 Thymocyte Antigen, R4, T Cell Surface Antigen Leu 6, Cell Surface Antigen T6, T Cell Surface Antigen T6/Leu-6, T Cell Surface Glycoprotein CD1A, T6, Thymocyte Antigen CD1A)
Sign In for Pricing
View Details 
