BCL2L12 Peptide - middle region
BCL2L12 Peptide - middle region
Product Specifications
Product Name Alternative
MGC120313, MGC120314, MGC120315
UniProt
Q9HB09
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BCL2L12 Rabbit Polyclonal Antibody (orb585107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_619580
Preservative
Lyophilized powder
AA Sequence
LEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP13625PU-N 400 µL
Choline kinase alpha (CHKA) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
H1847-53X-ML650 100 µL
Hemagglutinin Tag (YPYDVPDYA) (HA Tag) (MaxLight 650)
Sign In for Pricing
View Details 
MBS6468112-01 0.1 mL
CD44v3-v10 (CD44 Antigen, CD44 Molecule, Heparan Sulfate Proteoglycan, MUTCH 1, Phagocytic Glycoprotein I) (MaxLight 650)
Sign In for Pricing
View Details MBS6468112-02 5x 0.1 mL
CD44v3-v10 (CD44 Antigen, CD44 Molecule, Heparan Sulfate Proteoglycan, MUTCH 1, Phagocytic Glycoprotein I) (MaxLight 650)
Sign In for Pricing
View Details LUN19 A pack of Five Slides
Human Respiratory system Tisssue Secion
Sign In for Pricing
View Details