Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2L12 Peptide - middle region

BCL2L12 Peptide - middle region

Product Specifications

Product Name Alternative

MGC120313, MGC120314, MGC120315

UniProt

Q9HB09

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCL2L12 Rabbit Polyclonal Antibody (orb585107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619580

Preservative

Lyophilized powder

AA Sequence

LEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP7 Antibody
E043178 100 µg -100 µL

USP7 Antibody

Sign In for Pricing
View Details
Human Translational activator GCN1 (GCN1L1) ELISA Kit
MBS2802201-01 48 Tests

Human Translational activator GCN1 (GCN1L1) ELISA Kit

Sign In for Pricing
View Details
Human Translational activator GCN1 (GCN1L1) ELISA Kit
MBS2802201-02 96 Tests

Human Translational activator GCN1 (GCN1L1) ELISA Kit

Sign In for Pricing
View Details
Human Translational activator GCN1 (GCN1L1) ELISA Kit
MBS2802201-03 5x 96 Tests

Human Translational activator GCN1 (GCN1L1) ELISA Kit

Sign In for Pricing
View Details
Human Translational activator GCN1 (GCN1L1) ELISA Kit
MBS2802201-04 10x 96 Tests

Human Translational activator GCN1 (GCN1L1) ELISA Kit

Sign In for Pricing
View Details
PXK Adenovirus (Mouse)
38236054 1.0 mL

PXK Adenovirus (Mouse)

Sign In for Pricing
View Details