Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL7A Peptide - middle region

BCL7A Peptide - middle region

Product Specifications

Product Name Alternative

BCL7

UniProt

Q4VC05

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCL7A Rabbit Polyclonal Antibody (orb330925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066273

Preservative

Lyophilized powder

AA Sequence

CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOP (HOP Homeobox, Cameo, HOP, LAGY, MGC20820, NECC1, OB1, SMAP31, Toto)
247185 50 µL

HOP (HOP Homeobox, Cameo, HOP, LAGY, MGC20820, NECC1, OB1, SMAP31, Toto)

Sign In for Pricing
View Details
Rno-miR-3596a miRNA Agomir
CMS0653-01 5 nmol

Rno-miR-3596a miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-3596a miRNA Agomir
CMS0653-02 10 nmol

Rno-miR-3596a miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-3596a miRNA Agomir
CMS0653-03 20 nmol

Rno-miR-3596a miRNA Agomir

Sign In for Pricing
View Details
Multiplex Assay Kit for Erythrocyte Membrane Protein Band 4.2 (EPB42), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0030563 96 Tests

Multiplex Assay Kit for Erythrocyte Membrane Protein Band 4.2 (EPB42), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Transforming growth factor beta-3
orb1635786-01 50 µg

Transforming growth factor beta-3

Sign In for Pricing
View Details