BCL7A Peptide - middle region
BCL7A Peptide - middle region
Product Specifications
Product Name Alternative
BCL7
UniProt
Q4VC05
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BCL7A Rabbit Polyclonal Antibody (orb330925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066273
Preservative
Lyophilized powder
AA Sequence
CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
220885-01 50 µL
ASK1, phosphorylated (S966) (Apoptosis Signal Regulating Kinase 1, Apoptosis Signal-Regulating Kinase 1, ASK 1, ASK-1, ASK1, M3K5, MAP/ERK Kinase Kinase 5, MAP3K5, MAPK/ERK Kinase Kinase 5, MAPKKK5, MEK Kinase 5, MEKK 5, MEKK5, Mitogen Activated Protein Kinase Kinase Kinase 5, Mitogen-Activated Protein Kinase Kinase Kinase 5) discontinued
Sign In for Pricing
View Details 220885-02 100 µL
ASK1, phosphorylated (S966) (Apoptosis Signal Regulating Kinase 1, Apoptosis Signal-Regulating Kinase 1, ASK 1, ASK-1, ASK1, M3K5, MAP/ERK Kinase Kinase 5, MAP3K5, MAPK/ERK Kinase Kinase 5, MAPKKK5, MEK Kinase 5, MEKK 5, MEKK5, Mitogen Activated Protein Kinase Kinase Kinase 5, Mitogen-Activated Protein Kinase Kinase Kinase 5) discontinued
Sign In for Pricing
View Details