Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bclaf1 Peptide - middle region

Bclaf1 Peptide - middle region

Product Specifications

Product Name Alternative

Aa2-041, Bclaf1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bclaf1 Rabbit Polyclonal Antibody (orb574787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001041317

Preservative

Lyophilized powder

AA Sequence

TDGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1158 Mouse shRNA Plasmid (Locus ID 258639)
TR514923 1 Kit

Olfr1158 Mouse shRNA Plasmid (Locus ID 258639)

Sign In for Pricing
View Details
RPL7P55 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
41917111 3x 1.0 µg

RPL7P55 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rat Dynein Axonemal Heavy Chain 14 (DNAH14) ELISA Kit
MBS9938759-01 48 Well

Rat Dynein Axonemal Heavy Chain 14 (DNAH14) ELISA Kit

Sign In for Pricing
View Details
Rat Dynein Axonemal Heavy Chain 14 (DNAH14) ELISA Kit
MBS9938759-02 96 Well

Rat Dynein Axonemal Heavy Chain 14 (DNAH14) ELISA Kit

Sign In for Pricing
View Details
Rat Dynein Axonemal Heavy Chain 14 (DNAH14) ELISA Kit
MBS9938759-03 5x 96 Well

Rat Dynein Axonemal Heavy Chain 14 (DNAH14) ELISA Kit

Sign In for Pricing
View Details
Rat Dynein Axonemal Heavy Chain 14 (DNAH14) ELISA Kit
MBS9938759-04 10x 96 Well

Rat Dynein Axonemal Heavy Chain 14 (DNAH14) ELISA Kit

Sign In for Pricing
View Details