Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bclaf1 Peptide - middle region

Bclaf1 Peptide - middle region

Product Specifications

Product Name Alternative

Aa2-041, Bclaf1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bclaf1 Rabbit Polyclonal Antibody (orb574787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001041317

Preservative

Lyophilized powder

AA Sequence

TDGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SYDE1 Protein Lysate 20ug
IHUSYDE1PLLY20UG 20 µg

Human SYDE1 Protein Lysate 20ug

Sign In for Pricing
View Details
Anti-Menin/MEN1 Picoband® Antibody, APC Conjugate
A00331-1-APC 100 µg/Vial

Anti-Menin/MEN1 Picoband® Antibody, APC Conjugate

Sign In for Pricing
View Details
Ndufaf4 Mouse qPCR Primer Pair (NM_026742)
MP213008 200 Reactions

Ndufaf4 Mouse qPCR Primer Pair (NM_026742)

Sign In for Pricing
View Details
Vmn1r194 CRISPR/Cas9 KO Plasmid (m)
sc-436956 20 µg

Vmn1r194 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
pML-EnCMV-UHMK1-3×FLAG-SV40-Neo Plasmid
PVT37624 2 µg

pML-EnCMV-UHMK1-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
PLIN1 (Perilipin-1, Lipid Droplet-associated Protein, PERI, PLIN) (Biotin)
MBS6389803-01 0.1 mL

PLIN1 (Perilipin-1, Lipid Droplet-associated Protein, PERI, PLIN) (Biotin)

Sign In for Pricing
View Details