Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCO2 Peptide - C-terminal region

BCO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B-DIOX-II, BCDO2, FLJ34464

UniProt

Q9BYV7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCO2 Rabbit Polyclonal Antibody (orb584728) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032367

Preservative

Lyophilized powder

AA Sequence

DNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-[2- (Aminocarbonyl) phenyl]-4-chloro-3-nitrobenzenecarboxamide
sc-330773A 1 g

N-[2- (Aminocarbonyl) phenyl]-4-chloro-3-nitrobenzenecarboxamide

Sign In for Pricing
View Details
HSPA8 siRNA (Rat)
MBS8207862-01 15 nmol

HSPA8 siRNA (Rat)

Sign In for Pricing
View Details
HSPA8 siRNA (Rat)
MBS8207862-02 30 nmol

HSPA8 siRNA (Rat)

Sign In for Pricing
View Details
HSPA8 siRNA (Rat)
MBS8207862-03 5x 30 nmol

HSPA8 siRNA (Rat)

Sign In for Pricing
View Details
RAVER1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV661198 1.0 µg DNA

RAVER1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit Polyclonal ZFP28 Antibody [Janelia Fluor 646]
NBP3-06636JF646 0.1 mL

Rabbit Polyclonal ZFP28 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details