Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCO2 Peptide - C-terminal region

BCO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B-DIOX-II, BCDO2, FLJ34464

UniProt

Q9BYV7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCO2 Rabbit Polyclonal Antibody (orb584728) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032367

Preservative

Lyophilized powder

AA Sequence

DNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3EAP Adenovirus (Mouse)
15539054 1.0 mL

CD3EAP Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse Transmembrane protein 158, TMEM158 ELISA Kit
MBS9329108-01 48 Well

Mouse Transmembrane protein 158, TMEM158 ELISA Kit

Sign In for Pricing
View Details
Mouse Transmembrane protein 158, TMEM158 ELISA Kit
MBS9329108-02 96 Well

Mouse Transmembrane protein 158, TMEM158 ELISA Kit

Sign In for Pricing
View Details
Mouse Transmembrane protein 158, TMEM158 ELISA Kit
MBS9329108-03 5x 96 Well

Mouse Transmembrane protein 158, TMEM158 ELISA Kit

Sign In for Pricing
View Details
Mouse Transmembrane protein 158, TMEM158 ELISA Kit
MBS9329108-04 10x 96 Well

Mouse Transmembrane protein 158, TMEM158 ELISA Kit

Sign In for Pricing
View Details
GremLin-1 / GREM1 (25-184, His-tag) Human Protein
AR50785PU-N 500 µg

GremLin-1 / GREM1 (25-184, His-tag) Human Protein

Sign In for Pricing
View Details