Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BECN1 Peptide - middle region

BECN1 Peptide - middle region

Product Specifications

Product Name Alternative

ATG6, VPS30, beclin1

UniProt

Q14457

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BECN1 Rabbit Polyclonal Antibody (orb584145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003757

Preservative

Lyophilized powder

AA Sequence

ENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Peroxiredoxin 6/PRDX6, C-His Tag
HA211191-01 20 µg

Human Peroxiredoxin 6/PRDX6, C-His Tag

Sign In for Pricing
View Details
Human Peroxiredoxin 6/PRDX6, C-His Tag
HA211191-02 50 µg

Human Peroxiredoxin 6/PRDX6, C-His Tag

Sign In for Pricing
View Details
Human Peroxiredoxin 6/PRDX6, C-His Tag
HA211191-03 100 µg

Human Peroxiredoxin 6/PRDX6, C-His Tag

Sign In for Pricing
View Details
Proteasome 20S alpha 5 (PSMA5) (N-term) Rabbit Polyclonal Antibody
AP11427PU-N 400 µL

Proteasome 20S alpha 5 (PSMA5) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COMMD10 Rabbit Polyclonal Antibody
TA369627 100 µL

COMMD10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclothiazide
TRC-C988960-250MG 250 mg

Cyclothiazide

Sign In for Pricing
View Details