Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BECN1 Peptide - middle region

BECN1 Peptide - middle region

Product Specifications

Product Name Alternative

ATG6, VPS30, beclin1

UniProt

Q14457

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BECN1 Rabbit Polyclonal Antibody (orb584145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003757

Preservative

Lyophilized powder

AA Sequence

ENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), 0.2mg/mL
BNUB1045-500 1x 500 µL

CD16 (C16/1045), 0.2mg/mL

Sign In for Pricing
View Details
Repetin (RPTN) Human Gene Knockout Kit (CRISPR)
KN426166 1 Kit

Repetin (RPTN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human POTED activation kit by CRISPRa
GA117322 1 Kit

Human POTED activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS800832 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS710378 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
Bovine Vascular Endothelial Growth Factor D (VEGFD) ELISA Kit
RD-VEGFD-b-01 96 Tests

Bovine Vascular Endothelial Growth Factor D (VEGFD) ELISA Kit

Sign In for Pricing
View Details