Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEST3 Peptide - C-terminal region

BEST3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC13168, MGC40411, VMD2L3

UniProt

B5MDI8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEST3 Rabbit Polyclonal Antibody (orb580980) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689652

Preservative

Lyophilized powder

AA Sequence

VPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGK (Ab-422) Antibody
8B0087-AAT 50 µg

SGK (Ab-422) Antibody

Sign In for Pricing
View Details
Rb2 p130 (RBL2) Rabbit Polyclonal Antibody
TA371228 100 µL

Rb2 p130 (RBL2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PIP5K3 (PIKFYVE) ELISA Kit 1 x 96
EA200075 96 Well

Human PIP5K3 (PIKFYVE) ELISA Kit 1 x 96

Sign In for Pricing
View Details
SCAND1 (NM_016558) Human Recombinant Protein
TP304370 20 µg

SCAND1 (NM_016558) Human Recombinant Protein

Sign In for Pricing
View Details
Human LUZP6 activation kit by CRISPRa
GA119053 1 Kit

Human LUZP6 activation kit by CRISPRa

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD66b Antibody[G10F5]
E-AB-F1267H-01 20 Tests

PE/Cyanine7 Anti-Human CD66b Antibody[G10F5]

Sign In for Pricing
View Details