Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEST3 Peptide - C-terminal region

BEST3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC13168, MGC40411, VMD2L3

UniProt

B5MDI8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEST3 Rabbit Polyclonal Antibody (orb580980) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689652

Preservative

Lyophilized powder

AA Sequence

VPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF568 conjugate, 0.1mg/mL
BNC681970-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Behenamide
TRC-B131150-5G 5 g

Behenamide

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561862 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
6-Acetylbenzodioxane
TRC-D454903-10MG 10 mg

6-Acetylbenzodioxane

Sign In for Pricing
View Details
Human HAO2 activation kit by CRISPRa
GA109629 1 Kit

Human HAO2 activation kit by CRISPRa

Sign In for Pricing
View Details
Von Willebrand Factor (VWF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D3]
TA803626BM 100 µL

Von Willebrand Factor (VWF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D3]

Sign In for Pricing
View Details