Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bhlhb4 Peptide - N-terminal region

Bhlhb4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A930001L02Rik, BETA4, Bhlhb4

UniProt

Q8BGW3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bhlhb4 Rabbit Polyclonal Antibody (orb324703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542372

Preservative

Lyophilized powder

AA Sequence

MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tgfb2 Mouse Gene Knockout Kit (CRISPR)
KN317484 1 Kit

Tgfb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HS2ST1 (NM_012262) Human Over-expression Lysate
LC402186 20 µg

HS2ST1 (NM_012262) Human Over-expression Lysate

Sign In for Pricing
View Details
N-(3-Acetyl-4-hydroxyphenyl)butanamide
TRC-A178975-25G 25 g

N-(3-Acetyl-4-hydroxyphenyl)butanamide

Sign In for Pricing
View Details
RAGE Recombinant Rabbit monoclonal Antibody
HA750341 100 µL

RAGE Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human RBFOX1 activation kit by CRISPRa
GA110227 1 Kit

Human RBFOX1 activation kit by CRISPRa

Sign In for Pricing
View Details
Nonanoic-6,6,7,7-d4 Acid
TRC-N649386-2MG 2 mg

Nonanoic-6,6,7,7-d4 Acid

Sign In for Pricing
View Details