Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bhlhb4 Peptide - N-terminal region

Bhlhb4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A930001L02Rik, BETA4, Bhlhb4

UniProt

Q8BGW3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bhlhb4 Rabbit Polyclonal Antibody (orb324703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542372

Preservative

Lyophilized powder

AA Sequence

MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (2H11), CF405S conjugate, 0.1mg/mL
BNC040023-100 1x 100 µL

Thyroglobulin (2H11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p53R2 (RRM2B) Rabbit Polyclonal Antibody
TA362635 100 µL

p53R2 (RRM2B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CASP8 Monoclonal Antibody
E-AB-22107-01 20 µL

CASP8 Monoclonal Antibody

Sign In for Pricing
View Details
CASP8 Monoclonal Antibody
E-AB-22107-02 60 µL

CASP8 Monoclonal Antibody

Sign In for Pricing
View Details
CASP8 Monoclonal Antibody
E-AB-22107-03 120 µL

CASP8 Monoclonal Antibody

Sign In for Pricing
View Details
CASP8 Monoclonal Antibody
E-AB-22107-04 200 µL

CASP8 Monoclonal Antibody

Sign In for Pricing
View Details