Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bhlhe41 Peptide - N-terminal region

Bhlhe41 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Bhlhb3, Dec2, SHARP-1, Sharp1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bhlhe41 Rabbit Polyclonal Antibody (orb574736) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001074956

Preservative

Lyophilized powder

AA Sequence

QLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPFFR1, Control Peptide (Neuropeptide FF Receptor 1, G-protein Coupled Receptor 147, RFamide-related Peptide Receptor OT7T022, GPR147, NPFF1, FLJ10751)
148775 100 µg

NPFFR1, Control Peptide (Neuropeptide FF Receptor 1, G-protein Coupled Receptor 147, RFamide-related Peptide Receptor OT7T022, GPR147, NPFF1, FLJ10751)

Sign In for Pricing
View Details
Rabbit Anti Human GRPR Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot, IHC, ELISA) 200UL
IRBAMLGRPRAP44200UL 200 µL

Rabbit Anti Human GRPR Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot, IHC, ELISA) 200UL

Sign In for Pricing
View Details
L-Carnitine hydrochloride
MBS3600022-01 5 mg

L-Carnitine hydrochloride

Sign In for Pricing
View Details
L-Carnitine hydrochloride
MBS3600022-02 10 mg

L-Carnitine hydrochloride

Sign In for Pricing
View Details
L-Carnitine hydrochloride
MBS3600022-03 25 mg

L-Carnitine hydrochloride

Sign In for Pricing
View Details
L-Carnitine hydrochloride
MBS3600022-04 50 mg

L-Carnitine hydrochloride

Sign In for Pricing
View Details