Bhlhe41 Peptide - N-terminal region
Bhlhe41 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Bhlhb3, Dec2, SHARP-1, Sharp1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Bhlhe41 Rabbit Polyclonal Antibody (orb574736) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_001074956
Preservative
Lyophilized powder
AA Sequence
QLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRIN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1640520-01 50 µg
Interferon-induced helicase C domain-containing protein 1
Sign In for Pricing
View Details