Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BID Peptide - C-terminal region

BID Peptide - C-terminal region

Product Specifications

Product Name Alternative

FP497, MGC15319, MGC42355

UniProt

B3KT21

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BID Rabbit Polyclonal Antibody (orb584879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_932070

Preservative

Lyophilized powder

AA Sequence

LRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General 5-Hydroxytryptamine (5-HT) ELISA Kit DIY Materials
MBS2088817-01 5x 96 Tests

General 5-Hydroxytryptamine (5-HT) ELISA Kit DIY Materials

Sign In for Pricing
View Details
General 5-Hydroxytryptamine (5-HT) ELISA Kit DIY Materials
MBS2088817-02 5x 96 Tests + MBS2089472 (Support Pack 2,5x 96 Tests)

General 5-Hydroxytryptamine (5-HT) ELISA Kit DIY Materials

Sign In for Pricing
View Details
General 5-Hydroxytryptamine (5-HT) ELISA Kit DIY Materials
MBS2088817-03 10x 96 Tests

General 5-Hydroxytryptamine (5-HT) ELISA Kit DIY Materials

Sign In for Pricing
View Details
General 5-Hydroxytryptamine (5-HT) ELISA Kit DIY Materials
MBS2088817-04 10x 96 Tests + MBS2089472 (Support Pack 2, 10x 96 Tests)

General 5-Hydroxytryptamine (5-HT) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Anti-ErbB 4/ERBB4 Antibody Picoband® (Dylight488 Conjugate)
PA1881-Dylight488 100 µg

Anti-ErbB 4/ERBB4 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
DYRK2 Polyclonal Antibody, Cy5 Conjugated
bs-12332R-Cy5 100 µL

DYRK2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details