Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmp10 Peptide - N-terminal region

Bmp10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Bmp10

UniProt

Q4AEG6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bmp10 Rabbit Polyclonal Antibody (orb579938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001026994

Preservative

Lyophilized powder

AA Sequence

KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)
E-BC-K205-S-01 50 Assays (46 samples)

Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)

Sign In for Pricing
View Details
Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)
E-BC-K205-S-02 100 Assays (96 samples)

Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)

Sign In for Pricing
View Details
Streptavidin, CF®680R Conjugate
#29072 1x 1 mg

Streptavidin, CF®680R Conjugate

Sign In for Pricing
View Details
CCDC120 (NM_001163321) Human Recombinant Protein
TP328522L 1 mg

CCDC120 (NM_001163321) Human Recombinant Protein

Sign In for Pricing
View Details
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA392561 100 µL

PPAR delta (PPARD) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BUB1B-PAK6 (NM_001128629) Human Over-expression Lysate
LY426986 100 µg

BUB1B-PAK6 (NM_001128629) Human Over-expression Lysate

Sign In for Pricing
View Details