Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmp10 Peptide - N-terminal region

Bmp10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Bmp10

UniProt

Q4AEG6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bmp10 Rabbit Polyclonal Antibody (orb579938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001026994

Preservative

Lyophilized powder

AA Sequence

KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KCNS3 activation kit by CRISPRa
GA102563 1 Kit

Human KCNS3 activation kit by CRISPRa

Sign In for Pricing
View Details
Polyethylenimine, Linear, MW 25000, Transfection Grade (PEI 25K„¢)
23966-100 100 mg

Polyethylenimine, Linear, MW 25000, Transfection Grade (PEI 25K„¢)

Sign In for Pricing
View Details
Cicletanine-d4 Hydrochloride
TRC-C432702-1MG 1 mg

Cicletanine-d4 Hydrochloride

Sign In for Pricing
View Details
METTL3 Recombinant Rabbit monoclonal Antibody
HA750470 100 µL

METTL3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
7ß-Hydroxycholesterol-d7
TRC-H917964-5MG 5 mg

7ß-Hydroxycholesterol-d7

Sign In for Pricing
View Details
Recombinant Human IL6ST/CD130 Protein (His & Fc Tag)
PKSH031330-01 20 µg

Recombinant Human IL6ST/CD130 Protein (His & Fc Tag)

Sign In for Pricing
View Details