Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmp2 Peptide - middle region

Bmp2 Peptide - middle region

Product Specifications

Product Name Alternative

Bmp2

UniProt

P49001

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bmp2 Rabbit Polyclonal Antibody (orb579383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058874

Preservative

Lyophilized powder

AA Sequence

EEKPGVSKRHVRISRSLHQDEHSWSQVRPLLVTFGHDGKGHPLHKREKRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TORC1 (CRTC1) (NM_015321) Human Over-expression Lysate
LH09609V 100 µg

TORC1 (CRTC1) (NM_015321) Human Over-expression Lysate

Sign In for Pricing
View Details
Cy5-bifunctional dye
TD0014-01 1 mg

Cy5-bifunctional dye

Sign In for Pricing
View Details
Cy5-bifunctional dye
TD0014-02 5 mg

Cy5-bifunctional dye

Sign In for Pricing
View Details
Cy5-bifunctional dye
TD0014-03 10 mg

Cy5-bifunctional dye

Sign In for Pricing
View Details
Cy5-bifunctional dye
TD0014-04 25 mg

Cy5-bifunctional dye

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans nhr-62 Polyclonal Antibody
MBS7180466 Inquire

Rabbit anti-Caenorhabditis elegans nhr-62 Polyclonal Antibody

Sign In for Pricing
View Details